PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678292337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 292aa    MW: 31408 Da    PI: 8.3019
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678292337genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.38.4e-64161452132
     DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkss 101
                 ++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrkg kp+ + +++g+sa+++p+ss + s++ss
  678292337  16 VGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEPDGTTYRKGRKPM-SIDVVGTSANITPSSSRNPSPRSS 114
                689************************************************************************.************************ PP

     DUF822 102 alaspvesysaspksssfpspssldsislas 132
                ++asp++sy +s +ss +psps+ + ++++ 
  678292337 115 YFASPIPSYLPSSSSSYYPSPSRQNANNNHI 145
                ***********************88876653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.8E-5917142IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGGSTSPAEG ADGGGVGRRK PSWRERENNR RRERRRRAIA AKIYAGLRAQ GNYNLPKHCD  60
NNEVLKALCA EAGWVVEPDG TTYRKGRKPM SIDVVGTSAN ITPSSSRNPS PRSSYFASPI  120
PSYLPSSSSS YYPSPSRQNA NNNHIATLLH SSSSCPVTPP LYSPSKPPQQ SYNLETLATE  180
SMSLLNIPFS APASPTRGQR LAPAPIPECD EMDTTATVAP GQWLNFLASS INTAPASPTF  240
NLVKPVGKLD STVDGASGEG KGKEFDFGNV ALMAWEGERI HEEGMDDLEL TL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11736RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-114PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-83BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-102A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-100(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-73BES1 family protein